Goalign: toolkit and api for alignment manipulation

December 21, 2018 ยท View on GitHub

Commands

phase

This command "phases" input sequences on the basis on either a set of input sequences, or the longest detected orf. To do so, phase will:

  1. Search for the longest ORF in the dataset if no reference orf(s) is(are) given;
  2. Translate the given ORF(s) in aminoacids;
  3. For each sequence of the dataset: translate it in the 3 phases (or 6 if --reverse is given), align it with all the translated orfs, and take the phase and the reference orf giving the best alignment; If no phase gives a good alignment in any reference orf (cutoffs given by --len-cutoff and --match-cutoff), then the sequence flagged as removed;
  4. For each sequence, take the Start corresponding to the Start of the ORF, and remove nucleotides before (and nucleotides after if --cut-end is given);
  5. Return the trimmed nucleotidic sequences (phased), the corresponding amino-acid sequences (phasedaa) and the start position on the original nt sequence;
  6. The log file contains information on:
    1. Sequence name
    2. Its best matching reference orf
    3. Start position on original nt sequence
    4. Extracted sequence length
    5. Position of the first stop in phase

if --unaligned is set, format options are ignored (phylip, nexus, etc.), and only Fasta is accepted. Otherwise, alignment is first "unaligned".

If input sequences are not nucleotidic, then returns an error.

Output file is an unaligned set of sequences in fasta.

Usage

Usage:
  goalign phase [flags]

Flags:
      --aa-output string     Output Met "phased" aa FASTA file (default "none")
      --cut-end              Iftrue, then also remove the end of sequences that do not align with orf
  -h, --help                 help for phase
      --len-cutoff float     Length cutoff, over orf length, to consider sequence hits (-1==No cutoff) (default -1)
  -l, --log string           Output log: positions of the considered ATG for each sequence (default "none")
      --match float          Score for a match for pairwise alignment (if omitted, then take substitution matrix) (default 1)
      --match-cutoff float   Nb Matches cutoff, over alignment length, to consider sequence hits (-1==No cutoff) (default 0.5)
      --mismatch float       Score for a mismatch for pairwise alignment (if omitted, then take substitution matrix) (default -1)
  -o, --output string        Output ATG "phased" FASTA file (default "stdout")
      --ref-orf string       Reference ORF to phase against (if none is given, then will try to get the longest orf in the input data) (default "none")
      --reverse              Search ALSO in the reverse strand (in addition to the forward strand)
      --unaligned            Considers sequences as unaligned and only format fasta is accepted (phylip, nexus,... options are ignored)

Global Flags:
  -i, --align string    Alignment input file (default "stdin")
      --auto-detect     Auto detects input format (overrides -p, -x and -u)
  -u, --clustal         Alignment is in clustal? default fasta
      --input-strict    Strict phylip input format (only used with -p)
  -x, --nexus           Alignment is in nexus? default fasta
      --no-block        Write Phylip sequences without space separated blocks (only used with -p)
      --one-line        Write Phylip sequences on 1 line (only used with -p)
      --output-strict   Strict phylip output format (only used with -p)
  -p, --phylip          Alignment is in phylip? default fasta
      --seed int        Random Seed: -1 = nano seconds since 1970/01/01 00:00:00 (default -1)
  -t, --threads int     Number of threads (default 1)

Examples

input.fa

>allcodons
GCTGCCGCAGCGTTATTGCTTCTCCTACTGCGTCGCCGACGGAGAAGGAAAAAGAATAACATG
GATGACTTTTTCTGTTGCCCTCCCCCACCGCAACAGTCTTCCTCATCGAGTAGCGAAGAGACT
ACCACAACGGGTGGCGGAGGGTGGCATCACTATTACATTATCATAGTTGTCGTAGTGTAATGA
TAGC
>allcodons2
GCTGCAGCGTTATTGCTTCTCCTACTGCGTCGCCGACGGAGAAGGAAAAAGAATAACATG
GATGACTTTTTCTGTTGCCCTCCCCCACCGCAACAGTCTTCCTCATCGAGTAGCGAAGAGACT
ACCACAACGGGTGGCGGAGGGTGGCATCACTATTACATTATCATAGTTGTCGTATAATGA
goalign phase -i input.fa --unaligned -o stdout --aa-output aa.fa

should give

stdout

>allcodons
ATGGATGACTTTTTCTGTTGCCCTCCCCCACCGCAACAGTCTTCCTCATCGAGTAGCGAAGAGACTACCACAACGGGTGG
CGGAGGGTGGCATCACTATTACATTATCATAGTTGTCGTAGTGTAATGATAGC
>allcodons2
ATGGATGACTTTTTCTGTTGCCCTCCCCCACCGCAACAGTCTTCCTCATCGAGTAGCGAAGAGACTACCACAACGGGTGG
CGGAGGGTGGCATCACTATTACATTATCATAGTTGTCGTATAATGA

aa.fa

>allcodons
MDDFFCCPPPPQQSSSSSSEETTTTGGGGWHHYYIIIVVVV***
>allcodons2
MDDFFCCPPPPQQSSSSSSEETTTTGGGGWHHYYIIIVVV**