End-to-end protein-ligand complex structure generation with diffusion-based generative models
June 7, 2023 ยท View on GitHub
Setup Environment
Clone this repository and install dependencies:
git clone https://github.com/shuyana/DiffusionProteinLigand.git
cd DiffusionProteinLigand
conda env create -f environment.yml
conda activate dpl
Download model parameters:
gdown --fuzzy --folder https://drive.google.com/drive/u/1/folders/1AAJ4P5EmQtwle9_eSeNMcF-KMWObksxZ
Additionally, TMalign is required to align generated structures. You can install it as follows:
wget https://zhanggroup.org/TM-align/TMalign.cpp
g++ -static -O3 -ffast-math -lm -o TMalign TMalign.cpp
chmod +x TMalign
export PATH="/path/to/TMalign:$PATH"
Sample generation
Generate complex structures with the protein structure-free model (DPL):
python generate.py \
--ckpt_path "checkpoints/DPL_v1.ckpt" \
--output_dir "workdir/generate/example_DPL" \
--protein "LSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD" \
--ligand "Cc1ccc2c(c1c3cc(cc4c3nc([nH]4)C5CC5)c6c(noc6C)C)cccn2" \
--num_samples 8
Alternatively, the protein structure-dependent model (DPL+S) can be used:
wget https://files.rcsb.org/download/6MOA.pdb
python generate.py \
--ckpt_path "checkpoints/DPLS_v1.ckpt" \
--output_dir "workdir/generate/example_DPLS" \
--protein "6MOA.pdb" \
--ligand "Cc1ccc2c(c1c3cc(cc4c3nc([nH]4)C5CC5)c6c(noc6C)C)cccn2" \
--num_samples 8
Note that an input protein structure must be given as a PDB file in this case.
Besides, you can specify a reference protein structure to be used for the alignment of results:
python generate.py \
--ckpt_path "checkpoints/DPL_v1.ckpt" \
--output_dir "workdir/generate/example_DPL_ref" \
--protein "LSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD" \
--ligand "Cc1ccc2c(c1c3cc(cc4c3nc([nH]4)C5CC5)c6c(noc6C)C)cccn2" \
--num_samples 8 \
--ref_path "6MOA.pdb"
This is used only for alignment and does not affect the generation process itself.
The argument num_steps can be modified from the default of 64 to reduce execution time:
python generate.py \
--ckpt_path "checkpoints/DPL_v1.ckpt" \
--output_dir "workdir/generate/example_DPL_fast" \
--protein "LSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD" \
--ligand "Cc1ccc2c(c1c3cc(cc4c3nc([nH]4)C5CC5)c6c(noc6C)C)cccn2" \
--num_samples 8 \
--ref_path "6MOA.pdb" \
--num_steps 24
Training
Download the PDBbind dataset from https://zenodo.org/record/6408497 and unzip it.
Move the resulting PDBBind_processed directory to data/.
Preprocess the dataset:
python preprocess_pdbbind.py
Finally, run the training script:
python train.py \
--num_workers 8 \
--batch_size 1 \
--accumulate_grad_batches 8 \
--no_cb_distogram \
--save_dir "workdir/train/example_DPL" \
--single_dim 256 \
--pair_dim 32 \
--num_blocks 4
where the no_cb_distogram argument makes the model protein structure-free.
Please modify the batch_size and accumulate_grad_batches arguments according to your machine(s).
Default values can be used to reproduce the settings used in our paper:
python train.py \
--num_workers 8 \
--batch_size 3 \
--accumulate_grad_batches 8 \
--no_cb_distogram \
--save_dir "workdir/train/reproduce_DPL"
Citation
@article{Nakata2023,
doi = {10.1186/s12859-023-05354-5},
url = {https://doi.org/10.1186/s12859-023-05354-5},
year = {2023},
month = jun,
publisher = {Springer Science and Business Media {LLC}},
volume = {24},
number = {1},
author = {Shuya Nakata and Yoshiharu Mori and Shigenori Tanaka},
title = {End-to-end protein{\textendash}ligand complex structure generation with diffusion-based generative models},
journal = {{BMC} Bioinformatics}
}
Acknowledgements
Our work is based on the following repositories: